Un'appartenenza premio per i fornitori di più alto livello.

I prodotti che abbiamo fornito sono per la ricerca o la produzione del laboratorio soltanto, severo direttamente per i consumi privati.

 

 

Benvenuto
prodotti
su di noi
Visita della fabbrica
Controllo di qualità
Contattaci
Richiedere un preventivo
Casa ProdottiRicerca dell'ormone del peptide

FOXO4 D - retro - purezza del peptide FOXO4 DRI 98% di ricerca di Inverso DRI

Certificazione
di buona qualità Api del peptide per le vendite
di buona qualità Api del peptide per le vendite
Buon prezzo. Il prodotto è il di gran lunga la cosa migliore, molto piacevole e felice, comprerà ancora.

—— ****** S Regno Unito di K

L'elevata purezza, trasporto veloce, ha raccomandato questa società.

—— Stato unito t del ***** del sidro di pere

Grande servizio sono stato tenuto informato circa il mio ordine che il tempo pieno ringrazia Jones.

—— **** Y Australia di E

Sono ora online in chat

FOXO4 D - retro - purezza del peptide FOXO4 DRI 98% di ricerca di Inverso DRI

Porcellana FOXO4 D - retro - purezza del peptide FOXO4 DRI 98% di ricerca di Inverso DRI fornitore
FOXO4 D - retro - purezza del peptide FOXO4 DRI 98% di ricerca di Inverso DRI fornitore FOXO4 D - retro - purezza del peptide FOXO4 DRI 98% di ricerca di Inverso DRI fornitore FOXO4 D - retro - purezza del peptide FOXO4 DRI 98% di ricerca di Inverso DRI fornitore

Grande immagine :  FOXO4 D - retro - purezza del peptide FOXO4 DRI 98% di ricerca di Inverso DRI

Dettagli:

Luogo di origine: La Cina
Marca: MOBELBIO
Certificazione: ISO,SGS

Termini di pagamento e spedizione:

Quantità di ordine minimo: 10mg
Prezzo: According to order amounts
Imballaggi particolari: Fiale o bottiglia
Tempi di consegna: entro 3-5 giorni
Termini di pagamento: T/T
Capacità di alimentazione: giorno 1gram/
Contact Now
Descrizione di prodotto dettagliata
Purezza: 97% min Aspetto: polvere bianca

 

  • Nome di prodotto: FOXO4 D-retro-Inverso peptide (DRI)
  • Sequenza
    H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH
  • Un codice di tre lettere
    H-D-Leu-D-Thr-D-Leu-D-Arg-D-Lys-D-Glu-D-Pro-D-Ala-D-Ser-D-Glu-D-Ile-D-Ala-D-Gln-D-Ser-D-Ile-D-Leu-D-Glu-D-Ala-D-Tyr-D-Ser-D-Gln-D-Asn-D-Gly-D-Trp-D-Ala-D-Asn-D-Arg-D-Arg-D-Ser-D-Gly-D-Gly-D-Lys-D-Arg-D-Pro-D-Pro-D-Pro-D-Arg-D-Arg-D-Arg-D-Gln-D-Arg-D-Arg-D-Lys-D-Lys-D-Arg-D-Gly-OH
  • Lunghezza (aa): 46
  • Purezza del peptide (HPLC): Min di 97%
  • Formula molecolare: C228 H388 N86 O64
  • Peso molecolare: 5358,05
  • Fonte: Sintetico
  • Qualità: Vedi il COA, il ms, il HPLC, rapporti di MSDS
  • Descrizioni di FOXO4 DRI
  • FOXO4 D - retro - purezza del peptide FOXO4 DRI 98% di ricerca di Inverso DRI
    Il D-retro-Inverso peptide FOXO4, anche conosciuto come il peptide di FOXO4 DRI in primo luogo è stato riferito “in apoptosi mirati a delle cellule senescenti ristabilisce l'omeostasi del tessuto in risposta a Chemotoxicity e ad invecchiamento” dal peptide di Baar et al. FOXO4 DRI che comprende la sequenza aminoacidica: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, in cui gli aminoacidi nella sequenza aminoacidica detta sono residui acidi D-amminici. Il D-retro-Inverso peptide FOXO4 induce selettivamente gli apoptosi degli effetti senescenti degli inversi delle cellule del chemotoxicity e dell'invecchiamento nei topi.
  • Linee guida di stoccaggio
    FOXO4 il D-retro-Inverso peptide (DRI) dovrebbe essere immagazzinato Nel migliore dei casi in un congelatore pari o al di sotto di -9C. FOXO4 il D-retro-Inverso peptide (DRI) dovrebbe essere refrigerato dopo la ricostituzione. 
  •  
  • Nota: I prodotti è limitato in laboratorio, severo per privato consumano direttamente.
  •  

Dettagli di contatto
HANGZHOU MOBEL BIOTECHNOLOGY CO.,LTD

Persona di contatto: admin

Invia la tua richiesta direttamente a noi (0 / 3000)