Un'appartenenza premio per i fornitori di più alto livello.

I prodotti che abbiamo fornito sono per la ricerca o la produzione del laboratorio soltanto, severo direttamente per i consumi privati.

 

 

Benvenuto
prodotti
su di noi
Visita della fabbrica
Controllo di qualità
Contattaci
Richiedere un preventivo
Casa Prodotti

Ricerca dell'ormone del peptide

Certificazione
di buona qualità Api del peptide per le vendite
di buona qualità Api del peptide per le vendite
Buon prezzo. Il prodotto è il di gran lunga la cosa migliore, molto piacevole e felice, comprerà ancora.

—— ****** S Regno Unito di K

L'elevata purezza, trasporto veloce, ha raccomandato questa società.

—— Stato unito t del ***** del sidro di pere

Grande servizio sono stato tenuto informato circa il mio ordine che il tempo pieno ringrazia Jones.

—— **** Y Australia di E

Sono ora online in chat

Ricerca dell'ormone del peptide

(39)
Porcellana Ricerca GLYX 13 CAS numero 117928-94-6 dell'ormone del peptide di sintesi di Powerd fabbrica

Ricerca GLYX 13 CAS numero 117928-94-6 dell'ormone del peptide di sintesi di Powerd

Nome di prodotto GLYX-13 CAS no. 863288-34-0 Sinonimo Trifluoroacetate di L-Threonyl-L-prolyl-L-prolyl-L-threoninamide; Thr-Pro-Pro-Thr-NH2 trifluoroacetate, Rapastinel, trifluoroacetate dell'TPPT-amide Purezza ... Read More
2019-01-22 13:54:18
Porcellana Neuroprotective N - mediatori farmaceutici Cas 80714-61-0 del peptide di Semax dell'acetile fabbrica

Neuroprotective N - mediatori farmaceutici Cas 80714-61-0 del peptide di Semax dell'acetile

Neuroprotective N - purezza di Cas 80714-61-0 99% del peptide di Semax dell'acetile Peptide di Semax/ACTH intermedi farmaceutici (4-10) informazioni 1.Basic: Nome: Peptide di Semax Sinonimo: ACTH (4-10) Cas ... Read More
2019-01-22 13:54:17
Porcellana FOXO4- le fiale della purezza 10mg dell'aminoacido 98% del peptide di DRI liberano il trasporto fabbrica

FOXO4- le fiale della purezza 10mg dell'aminoacido 98% del peptide di DRI liberano il trasporto

VOLPE calda 04DRI/Senolytics di vendita 2018 Il D-retro-Inverso peptide FOXO4, anche conosciuto come il peptide di FOXO4 DRI in primo luogo è stato riferito “in apoptosi mirati a delle cellule senescenti ... Read More
2019-01-22 13:54:15
Porcellana Anticorpo umano che blocca le fiale del peptide Foxo4 con elevata purezza che spedisce liberamente fabbrica

Anticorpo umano che blocca le fiale del peptide Foxo4 con elevata purezza che spedisce liberamente

Fonte Essere umano, ricombinante Immunogeno 15 aminoacidi vicino all'estremità amminica di FOXO4 umano Formulazione Il peptide è fornito come soluzione di µg/ml 200 in PBS pH 7,2 (10 millimetri NaH del ₂ di ₄ ... Read More
2019-01-22 13:54:16
Porcellana Supplementi dell'ormone umano della crescita di HGH 191AA Cas 12629-01-5 per culturismo fabbrica

Supplementi dell'ormone umano della crescita di HGH 191AA Cas 12629-01-5 per culturismo

Supplementi dell'ormone umano della crescita di HGH 191AA Cas 12629-01-5 per culturismo Nome di prodotto: ormone umano della crescita HGH No. del EINECS: 235-735-8 CAS: 12629-01-5 Caratteristica: alta ... Read More
2019-03-01 14:20:59
Porcellana FOXO4 D - retro - purezza del peptide FOXO4 DRI 98% di ricerca di Inverso DRI fabbrica

FOXO4 D - retro - purezza del peptide FOXO4 DRI 98% di ricerca di Inverso DRI

Nome di prodotto: FOXO4 D-retro-Inverso peptide (DRI) Sequenza H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH Un codice di tre lettere H-D-Leu-D-Thr-D-Leu-D-Arg-D-Lys-D-Glu-D-Pro-D-Ala-D-Ser-D-Glu-D-Ile-D... Read More
2019-01-22 13:54:15
Porcellana Il blu completa le fiale dell'ormone umano della crescita 10iu dell'iniezione di HGH 191AA per i supplementi di culturismo fabbrica

Il blu completa le fiale dell'ormone umano della crescita 10iu dell'iniezione di HGH 191AA per i supplementi di culturismo

Descrizione: No. del EINECS: 235-735-8 CAS: 12629-01-5 Caratteristica: alta bioattività, alta stabilità, elevata purezza, un hgh di 191 aa Formula molecolare: C990H1528N262O300S7 Peso di formula: 22125D ... Read More
2019-01-22 13:54:14
Porcellana La TA -2 CAS dell'acetato di Melanotan II 121062-08-6 fiale 10mg per l'abbronzatura della pelle fabbrica

La TA -2 CAS dell'acetato di Melanotan II 121062-08-6 fiale 10mg per l'abbronzatura della pelle

Nome di prodotto: Melanotan2 L'altro nome: Melanotan 2, MT-II Sinonimi: Il CA-Nle-ciclo [Asp-suo-d-Phe-Arg-Trp-Lys] - NH2 CAS #: 121062-08-6 Purezza: min di 99%. Formula molecolare: C50H69N15O9 Peso molecolare: ... Read More
2019-02-19 10:30:06
Porcellana Il blu delle fiale di GH 191AA 10iu di somatropina completa il campione libero di norma di BP USP fabbrica

Il blu delle fiale di GH 191AA 10iu di somatropina completa il campione libero di norma di BP USP

Nome: r-Hg Aspetto: Polvere liofilizzata bianco Specificazione: 10 iu/vial 10vial/kit 100iu/kit Azione: In azione Abilità del rifornimento: Massa Consegna: FedeEx, SME, HKEMS, TNT, DHL, UPS Termine di consegna: ... Read More
2019-03-01 14:21:05
Porcellana Prezzo franco fabbrica d'abbronzatura di purezza 98% di Myristoyl Tetrapeptide-20 Dermapep T430 del peptide di auto della pelle fabbrica

Prezzo franco fabbrica d'abbronzatura di purezza 98% di Myristoyl Tetrapeptide-20 Dermapep T430 del peptide di auto della pelle

Myristoyl Tetrapeptide-20 informazioni 1.Basic: Nome di INCI: Myristoyl Tetrapeptide-20 Riferimento: Dermapep T430 Purezza: >98% Fonte: sintetico Formulazione: disponibile per il vostro riferimento, contattici ... Read More
2019-01-22 13:54:13
Page 1 of 4|< 1 2 3 4 >|